Prevotella melaninogenica: HMPREF0659_A5967 Help Entry HMPREF0659_A5967  CDS       T01286                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pmz  Prevotella melaninogenica Pathway pmz00020   Citrate cycle (TCA cycle) pmz00720   Other carbon fixation pathways pmz01100   Metabolic pathways pmz01110   Biosynthesis of secondary metabolites pmz01120   Microbial metabolism in diverse environments pmz01200   Carbon metabolism pmz01210   2-Oxocarboxylic acid metabolism Module pmz_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pmz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HMPREF0659_A5967   09102 Energy metabolism    00720 Other carbon fixation pathways     HMPREF0659_A5967 Enzymes [BR:pmz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HMPREF0659_A5967 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_4 LdpA_Fe-S-bd Fer4_16 Fer4_17 Fer4_15 Fer4_3 Fer4_8 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  ADK95475 LinkDB All DBs Position I:complement(1211982..1212215) Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVVNTDRCKGCQLCIVACPKDVIALAQKKVNVHGYPYTESARPDDCIGCAACA TVCPDGCITVYRKKVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggtgccattgtggtaaacacagatcgatgcaaaggatgccagttg tgtatcgttgcatgtccgaaagatgttattgctttggctcagaaaaaggttaatgtccac ggctatccgtatacagagtctgcacgaccagatgattgtattggttgtgctgcttgtgct acggtttgtcctgatggctgtatcacagtctatcgtaaaaaagtggaggaataa

DBGET integrated database retrieval system