Polaromonas naphthalenivorans: Pnap_3071 Help Entry Pnap_3071         CDS       T00459                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pna  Polaromonas naphthalenivorans Pathway pna01100   Metabolic pathways pna01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pna00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pnap_3071    00074 Mycolic acid biosynthesis     Pnap_3071   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pnap_3071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABM38370 UniProt:  A1VRU2 LinkDB All DBs Position complement(3244195..3244434) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEGQVTSEKSFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHHKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgttaagaaaatcattgccgaacaacttggcgttgaagaa ggtcaagtcaccagcgaaaagtcctttgtggccgatctgggcgctgattcccttgacacc gtagagctggtcatggcactggaagacgagtttggcattgaaattcccgacgaagacgcc gagaaaatcaccaccgtccaaaacgcgattgactacgccaacacccatcacaaggcctaa

DBGET integrated database retrieval system