KEGG   Polaromonas naphthalenivorans: Pnap_4151
Entry
Pnap_4151         CDS       T00459                                 

Definition
(GenBank) Benzene 1,2-dioxygenase
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00621  Dioxin degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Pnap_4151
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     Pnap_4151
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 AAA_32
Other DBs
NCBI-ProteinID: ABM39438
UniProt: A1VUW0
LinkDB
Position
pPNAP01:complement(24295..24861)
AA seq 188 aa
MTTPSTNLFKAFEWPSKAVGLELQNEIEQFYYREAQLLDHRAYEAWFALLEKDIRYFMPL
RTNRRLQESELEYSGDQDFAHFDETHETMYGRIRKVTSELGWAENPPSRTRHLVSNVMVR
EAAEPNTFEVSSAFILYRNRLERQVDIFAGERRDVLRRADNGLGFKIAKRTILLDQSTLL
ANNLSMFF
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacaaccccatccaccaatttgttcaaagcattcgaatggccaagcaaagccgttggc
cttgagttgcagaacgagatcgagcagttttactaccgcgaagcgcagttgcttgaccac
cgggcctacgaggcctggttcgctctgctggaaaaagacatccgctacttcatgccgttg
cgcaccaaccgcaggctccaggagagcgaactcgagtattccggcgaccaagatttcgcc
catttcgacgaaacccatgaaaccatgtacgggcgcatccgcaaggtgacctcggagctg
ggttgggcggagaacccgccttcccgtacacgccacctggtctccaatgtcatggttcgg
gaggcggctgagcccaacaccttcgaagtgagttcggccttcatcctgtaccgcaatcgt
ctggagcgccaggtcgacattttcgcgggcgagcgccgggacgtcctgcgccgtgccgac
aacggcctgggcttcaagatcgccaagcgcaccatcctgctcgaccagagcacgctgctg
gcgaacaacctgagcatgttcttctga

DBGET integrated database retrieval system