Pieris napi (green-veined white): 125049346 Help Entry 125049346         CDS       T08706                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pnap  Pieris napi (green-veined white) Pathway pnap04013   MAPK signaling pathway - fly pnap04145   Phagosome pnap04148   Efferocytosis pnap04310   Wnt signaling pathway pnap04517   IgSF CAM signaling pnap04518   Integrin signaling pnap04620   Toll-like receptor signaling pathway pnap05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pnap00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     125049346    04310 Wnt signaling pathway     125049346   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125049346    04518 Integrin signaling     125049346  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125049346    04148 Efferocytosis     125049346  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125049346  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     125049346  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pnap04131]     125049346   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pnap04147]     125049346    04031 GTP-binding proteins [BR:pnap04031]     125049346 Membrane trafficking [BR:pnap04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125049346  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     125049346   Macropinocytosis    Ras GTPases     125049346  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     125049346 Exosome [BR:pnap04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125049346   Exosomal proteins of other body fluids (saliva and urine)    125049346   Exosomal proteins of colorectal cancer cells    125049346   Exosomal proteins of bladder cancer cells    125049346 GTP-binding proteins [BR:pnap04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125049346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  125049346 NCBI-ProteinID:  XP_047504477 LinkDB All DBs Position 5:complement(6366311..6398168) Genome browser AA seq 193 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITWSQGLSMSKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPPKKKKPTCNIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgttgtagttggtgatggtgccgtcggtaaaacatgtctcctc atcagttatacaacgaatgccttcccaggagaatacatacctacagtgttcgacaactat tcggcgaatgtgatggtggacgggaagccaatcaacctgggtctctgggatacggctggt caagaggactacgataggctgcgaccactctcctacccgcagacggatgtcttcttaata tgcttctcgcttgtcaaccctgcctccttcgaaaacgtccgcgctaagtggtaccctgaa gtgaggcatcactgtccgtcgacccccatcatccttgtgggaactaagctcgatctccgt gaagacaaggacaccattgagaagttgaaggacaagaaacttgctcccatcacctggtca cagggcctaagcatgtccaaggagatcggtgcagtgaagtacctagagtgctcggcgctg acgcaaaagggcttgaagactgtttttgatgaggcgatacgagcggtactctgtcccgta caaccgccgaagaagaaaaagccaacctgtaatatcctataa

DBGET integrated database retrieval system