Pseudomonas nunensis: NK667_03570 Help Entry NK667_03570       CDS       T08997                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pnb  Pseudomonas nunensis Pathway pnb00998   Biosynthesis of various antibiotics pnb01100   Metabolic pathways pnb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NK667_03570 (acpP)    00074 Mycolic acid biosynthesis     NK667_03570 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NK667_03570 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UTO15455 LinkDB All DBs Position 773235..773471 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagtggtcaacactgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgattacgttactaaccaccaggcttaa

DBGET integrated database retrieval system