KEGG   Pseudomonas nunensis: NK667_19125
Entry
NK667_19125       CDS       T08997                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pnb  Pseudomonas nunensis
Pathway
pnb02020  Two-component system
pnb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pnb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NK667_19125
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    NK667_19125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pnb02022]
    NK667_19125
   02035 Bacterial motility proteins [BR:pnb02035]
    NK667_19125
Enzymes [BR:pnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NK667_19125
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     NK667_19125
Two-component system [BR:pnb02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   NK667_19125
Bacterial motility proteins [BR:pnb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NK667_19125
SSDB
Motif
Pfam: CheB_methylest Response_reg Ndc1_Nup
Other DBs
NCBI-ProteinID: UTO12280
UniProt: A0ABY5ED89
LinkDB
Position
complement(4377763..4378914)
AA seq 383 aa
MVVKVLVVDDSGFFRRRVSEILSADPNIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKILSISRSNRRANTYSAPAPAPAPVAAPAPAPSSTSSYGSTYGSSAPARPAPAPLP
TRAPASTGPSSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFT
KAFAERLDKLCRINVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPC
VDITFGSAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIV
KADLADAIYSLDDIGKHLVEACI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggtagtcaaagtcctggtggtggacgattcggggtttttccgccgccgcgtctcggaa
attctttcagcggatccgaacatccaggttgtcggtacggcaaccaacggaaaagaggcg
attgatcaggcgctggccctcaagccagacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggcggtgcggcacatcatgcagcgctgcccgactccggtcttgatg
ttctcctcgctgacgcacgaaggcgcccgggtcaccctggatgcgctggatgccggtgcg
gtggatttcctgccgaagaatttcgaagacatctcccgcaacccggagaaggtcaagcaa
ctgctgtgcgaaaagatcctgagcatttcgcgcagtaaccgtcgcgccaatacctacagt
gccccggccccggccccggccccggtggccgcgcctgcaccggcgccttcgagcaccagc
agctacggcagcacgtatggcagcagcgcgcctgcgcgtccggcaccggcacctttgccg
acccgtgcgccagcgtctaccggcccgtcgtcgcccgcaccgaaacgcaaagcctacaaa
ctggtggccatcggtacgtccaccggcggcccggttgcgctgcaacgggtcttgacccaa
ttgccggccaacttcccggcgccgatcgtgctgatccagcacatgccggcagccttcacc
aaggccttcgccgaacgcctcgacaagctgtgccgcatcaacgtcaaggaagccgaggat
ggcgacatcctgcgtcctggcctggcgctgctggctccgggtggcaagcaaatgatgatc
gatggccgtggcgcggtgaaaatcctgccgggcgacgagcgtctgaactacaaaccgtgc
gtggacatcacgttcggttcggcggccaaatcctacggtgacaaagttctggcggtcgtg
ttgaccggcatgggcgccgacggtcgtgaaggcgcgcgcctgctcaagcagggcggcagt
gcgatctgggcccaggatgaagccagttgcgtgatctacggcatgccgatggccatcgtc
aaagctgacctcgcggacgcgatttacagcctggacgacattggcaagcacctggtcgag
gcttgtatctga

DBGET integrated database retrieval system