Pseudomonas nunensis: NK667_24975 Help Entry NK667_24975       CDS       T08997                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pnb  Pseudomonas nunensis Pathway pnb00998   Biosynthesis of various antibiotics pnb01100   Metabolic pathways pnb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NK667_24975    00074 Mycolic acid biosynthesis     NK667_24975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NK667_24975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Decorin_bind Motif Other DBs NCBI-ProteinID:  UTO13393 LinkDB All DBs Position 5691921..5692175 Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELDPERVSLESNLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKSVRTVSDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatatcttcaacaccctgcgcgatgccctggtcgaactcttcgag ctggaccctgagcgcgtgagcctggaatccaacctgtatcaggatctggaaatcgacagc atcgacgccgtcgacctgatcgatcacatcaagcgccagaccggcaagaaaatcgccgcc gaagaattcaaatcggtgcgtaccgtcagcgatgtggtcgaggcggtctaccgtctggtt caaccggccgcatga

DBGET integrated database retrieval system