Pseudomonas nunensis: NK667_28830 Help Entry NK667_28830       CDS       T08997                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pnb  Pseudomonas nunensis Brite KEGG Orthology (KO) [BR:pnb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pnb03036]     NK667_28830 Chromosome and associated proteins [BR:pnb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     NK667_28830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB TPR_MLP1_2 VGPC1_C Macoilin Motif Other DBs NCBI-ProteinID:  UTO14122 LinkDB All DBs Position complement(6542693..6542902) Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLISRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgatctgcaagcgctgatggcaagacttgagctgctaattagccgagtc gagcaactaaagagccaaaacggactcctattagcgcaggaaaaaacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaagccctggagcaagactcatga

DBGET integrated database retrieval system