Pirellulimonas nuda: Pla175_15200 Help Entry Pla175_15200      CDS       T06953                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism pnd  Pirellulimonas nuda Pathway pnd02020   Two-component system pnd02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pnd00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Pla175_15200  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Pla175_15200  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pnd02035]     Pla175_15200 Bacterial motility proteins [BR:pnd02035]  Flagellar system   Flagellar assembly proteins    Others     Pla175_15200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF1002 Motif Other DBs NCBI-ProteinID:  QDU88149 UniProt:  A0A518D9I7 LinkDB All DBs Position complement(1818023..1818289) Genome browser AA seq 88 aa AA seqDB search MNVSGPSHVHSAHGVNAPHTLRGPHRPTSAAPQTVDKLEISEAARAASQSTGVRSDLVAR IRSEIASGSYETPQKIDSAVERLLDQLG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacgtctctggccccagccacgtccacagcgcccacggcgtcaacgcaccgcacacc ctgcgtgggccccaccgccccacgagcgcggccccccagaccgtcgacaagctagagatc tccgaagcggctcgtgcggcctcgcagtcgaccggcgtccgcagcgacttggtcgctcgg atccgctctgagatcgctagcggctcctacgaaacgcctcaaaagatcgattccgctgtg gaacggctgcttgatcagctcggttag

DBGET integrated database retrieval system