KEGG   Pelagibacterium nitratireducens: V6617_11735
Entry
V6617_11735       CDS       T11031                                 
Name
(GenBank) LptF/LptG family permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
pnf  Pelagibacterium nitratireducens
Pathway
pnf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pnf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    V6617_11735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pnf02000]
    V6617_11735
Transporters [BR:pnf02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    V6617_11735
SSDB
Motif
Pfam: LptF_LptG Gate
Other DBs
NCBI-ProteinID: WWT31687
UniProt: A0ABZ2I3H1
LinkDB
Position
2358556..2359635
AA seq 359 aa
MDRLSRYLQSQFFAQALTIFAAGGALIWLMQLLRLFDLVSAKGQNFLTLMGQSGLTTPTF
ARSILYVCFAIGLVRGLRALQSSRELHTIHAGQRTDALWKAIISFTLAGAAIVTLVTNYI
EPHSRRISADWSAEIAADVVGRALVPGRFTEIEDGLVFSISARRRDGTLVDFFFDDTTNE
TRRTYFAETASVFQDETGYQLILNNGAIQYESAERQGLSQIRFAQYHISLASLIDAASRA
TSAAQTDSFGLMAKVLEGSATGEEIKMLNERFADTLRALAICALAAAFCAYPDGGRGRRR
MPMELVILLVAFAEQAVSAFSGGGGRHFIAPSVILAFSLSLLWLRSRRAFIFPRWRVAR
NT seq 1080 nt   +upstreamnt  +downstreamnt
ttggacagactttcgcgatatctgcagagccagttctttgcgcaggcgcttaccattttc
gcggcggggggcgcgctgatctggctgatgcagctgttgcggctgttcgatctggtttcg
gccaaggggcagaattttctcaccctgatgggccagagcgggctgacgacgccgaccttt
gcgcgctcgatcctttatgtgtgtttcgccatcgggctggtgcgggggttgcgggcgctg
caatcgtcgcgcgaattgcacacaatccatgccgggcagcgcaccgatgcgctgtggaag
gcgatcatttcgtttacgctggccggtgcggccatcgtgacgctggtcacaaattatatc
gaaccccattcacggcggatttcggcggactggtcggccgaaattgccgccgatgtggtc
ggaagggcactggtgccggggcggtttacggaaatcgaagacgggctggtgttttcgatt
tcggcgcggcggcgggacggaacgcttgtcgatttctttttcgacgacacgaccaacgaa
acccggcggacctattttgccgaaacggcatcggtgtttcaggatgaaaccggctatcag
ctgatcctcaacaatggcgccatccagtatgaaagcgccgagcggcagggtttgagccag
atccggttcgcccaataccatataagccttgcgagcctgatcgatgcggcgtcgcgcgcc
acgagcgcggcccagaccgacagtttcgggctgatggccaaggtgctggagggcagtgcg
acgggcgaagagatcaagatgctcaacgagcggttcgccgatacgctacgggcgctggcc
atctgcgcgctggcggcggcgttctgcgcctatcccgatggcgggcgcgggcggcggcgg
atgccgatggaactggtgatcctgctggtggcgtttgccgagcaggcggtgagcgcgttc
tcgggcggcgggggccgccatttcatcgcgccaagcgtgatccttgcgttctcgctgagc
ctgttgtggctgcgcagccggcgcgccttcatctttccgcgctggagggtggcacgatga

DBGET integrated database retrieval system