Prevotella nigrescens: J5A59_10060 Help Entry J5A59_10060       CDS       T07424                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pni  Prevotella nigrescens Pathway pni00020   Citrate cycle (TCA cycle) pni00720   Other carbon fixation pathways pni01100   Metabolic pathways pni01110   Biosynthesis of secondary metabolites pni01120   Microbial metabolism in diverse environments pni01200   Carbon metabolism pni01210   2-Oxocarboxylic acid metabolism Module pni_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pni00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     J5A59_10060   09102 Energy metabolism    00720 Other carbon fixation pathways     J5A59_10060 Enzymes [BR:pni01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      J5A59_10060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_2 Fer4_7 Fer4_6 Fer4_9 Fer4_10 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_8 Fer4_17 Fer4_3 Fer4_15 Fer4_22 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  QUB51659 LinkDB All DBs Position 1:complement(1785819..1786052) Genome browser AA seq 77 aa AA seqDB search MSKIKGAIVVNTDRCKGCQLCIIACPKDVIDMAQKQVNAHGYTYVEPVHADLCVGCAACA VVCPDGCITVYKKRVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagattaaaggagcaattgtcgttaacactgatagatgtaaaggctgtcaattg tgcattattgcctgtcctaaagatgtaattgacatggctcaaaagcaagttaatgcccat ggatatacatacgtagaacctgtacacgctgatttatgtgttggatgtgcagcttgtgct gtagtatgtcctgatggctgtatcactgtatacaaaaaaagagtggaggaataa

DBGET integrated database retrieval system