Parastagonospora nodorum: SNOG_00767 Help Entry SNOG_00767        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pno  Parastagonospora nodorum Pathway pno03060   Protein export pno04141   Protein processing in endoplasmic reticulum pno04145   Phagosome Brite KEGG Orthology (KO) [BR:pno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SNOG_00767    04141 Protein processing in endoplasmic reticulum     SNOG_00767  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SNOG_00767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pno04131]     SNOG_00767   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pno02044]     SNOG_00767 Membrane trafficking [BR:pno04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SNOG_00767 Secretion system [BR:pno02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SNOG_00767 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  5968075 NCBI-ProteinID:  XP_001791442 UniProt:  Q0V5E7 A0A7U2ESK8 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MENVKEFADMPAEFLKEGTLFMNRCTKPDKKEFIRISQAVGIGFLIMGVIGYIVKLVHIP VNNILVGGS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggagaacgtcaaggagtttgccgatatgcccgctgagttcctcaaggagggtactttg ttcatgaaccgctgcaccaagcccgacaagaaggagttcatcaggatctcgcaagcagtc ggaattggttttctgatcatgggcgtcatcggctacatcgtcaagctggtgcacatcccc gtaaacaacatcctcgtcggtggctcatag

DBGET integrated database retrieval system