Parastagonospora nodorum: SNOG_01275 Help Entry SNOG_01275        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism pno  Parastagonospora nodorum Pathway pno04136   Autophagy - other pno04138   Autophagy - yeast pno04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:pno00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     SNOG_01275    04136 Autophagy - other     SNOG_01275    04139 Mitophagy - yeast     SNOG_01275  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pno04131]     SNOG_01275    04121 Ubiquitin system [BR:pno04121]     SNOG_01275    03029 Mitochondrial biogenesis [BR:pno03029]     SNOG_01275 Membrane trafficking [BR:pno04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     SNOG_01275 Ubiquitin system [BR:pno04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    SNOG_01275 Mitochondrial biogenesis [BR:pno03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     SNOG_01275 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Hanta_Gn-B Motif Other DBs NCBI-GeneID:  5968766 NCBI-ProteinID:  XP_001791921 UniProt:  Q0V3Y9 A0A7U2HY96 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEAI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcgctccaagttcaaggacgagcacccgttcgagaagcgcaaggccgaggctgagcgc atccgccagaagtacaacgaccgcattcccgttatctgcgagaaggtcgagaagtcagac atcgcgaccatcgacaagaagaagtacctcgtcccagcggaccttaccgtaggccagttc gtctacgtgatccgcaagcgcatcaagctgtcgcccgagaaggccatcttcatcttcgtc gatgaggtcctgccgccgactgccgctctgatgagctcgatatacgaggagcacaaggac gaggatggcttcctctacatcacctactcgggcgagaacacgttcggcgaggcgatctag

DBGET integrated database retrieval system