Parastagonospora nodorum: SNOG_03677 Help Entry SNOG_03677        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism pno  Parastagonospora nodorum Pathway pno03018   RNA degradation pno03040   Spliceosome Brite KEGG Orthology (KO) [BR:pno00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     SNOG_03677   09123 Folding, sorting and degradation    03018 RNA degradation     SNOG_03677  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pno03019]     SNOG_03677    03041 Spliceosome [BR:pno03041]     SNOG_03677 Messenger RNA biogenesis [BR:pno03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      SNOG_03677   mRNA degradation factors    5'-3' decay     Lsm complex      SNOG_03677 Spliceosome [BR:pno03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     SNOG_03677 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX VWA_3_C CooT RimP_C LSM12_LSM Glyoxalase_7 Motif Other DBs NCBI-GeneID:  5971094 NCBI-ProteinID:  XP_001794231 UniProt:  A0A7U2EX04 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MATENLLPLELIDKCVGSQIWVIMNGGKEFTGKLVGFDDYVNMVLEEVTEIDPAEGNVKL PKILLNGNNICMMVPGGDGQTVLEDE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcaacagagaaccttctccccctcgaactcatcgacaaatgtgttggatcgcaaata tgggtcattatgaacggcggaaaggaattcaccggcaaacttgtaggatttgatgactac gtcaacatggttctcgaagaggtgaccgagatcgaccctgcggagggtaacgtgaagttg ccgaaaatcctcctcaacggcaacaacatctgcatgatggtaccaggcggagacggacag acggttctggaggacgagtaa

DBGET integrated database retrieval system