Parastagonospora nodorum: SNOG_08636 Help Entry SNOG_08636        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism pno  Parastagonospora nodorum Pathway pno03020   RNA polymerase pno03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pno00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SNOG_08636   09124 Replication and repair    03420 Nucleotide excision repair     SNOG_08636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pno03021]     SNOG_08636    03400 DNA repair and recombination proteins [BR:pno03400]     SNOG_08636 Transcription machinery [BR:pno03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SNOG_08636   RNA polymerase III system    RNA polymerase III      SNOG_08636   RNA polymerase I system    RNA polymerase I      SNOG_08636 DNA repair and recombination proteins [BR:pno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SNOG_08636 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 YycI Motif Other DBs NCBI-GeneID:  5975844 NCBI-ProteinID:  XP_001798945 UniProt:  Q0UHX8 A0A7U2HZF3 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MADAQLFEENFIVTKVNKEKYDRVHRLSGTSTDGSLTFTLDINHELWPVAEGSTINIVLA TTLALDGTTKEGAETSWRNVSRSNTATLADLFEYVCYGKNYRFEDAEAGAETVKYYASFG GMLLYIEGPYRKLNGLKIDEIYMLCKKA NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggccgacgcacaacttttcgaggaaaacttcattgtaaccaaggtaaacaaggaaaag tacgaccgcgtgcaccgcctttctggtacttcgaccgacggctccctcaccttcaccctg gacatcaaccacgagctgtggcccgtcgctgagggctcaactataaatatcgtccttgcg accacgcttgcgctcgacggcactaccaaagagggcgccgagacgagctggcggaacgtg agcagatccaacacggcgacgcttgcggatttgtttgaatacgtgtgctacggcaaaaac taccgatttgaggatgccgaggcgggggcggagactgtaaagtactacgccagcttcgga ggaatgctgctatacatcgagggaccatacaggaagctcaacggcctgaagattgacgaa atctacatgctgtgcaagaaagcttga

DBGET integrated database retrieval system