Parastagonospora nodorum: SNOG_10424 Help Entry SNOG_10424        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K10740   replication factor A3 Organism pno  Parastagonospora nodorum Pathway pno03030   DNA replication pno03420   Nucleotide excision repair pno03430   Mismatch repair pno03440   Homologous recombination pno03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pno00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     SNOG_10424    03420 Nucleotide excision repair     SNOG_10424    03430 Mismatch repair     SNOG_10424    03440 Homologous recombination     SNOG_10424    03460 Fanconi anemia pathway     SNOG_10424  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pno03032]     SNOG_10424    03400 DNA repair and recombination proteins [BR:pno03400]     SNOG_10424 DNA replication proteins [BR:pno03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     SNOG_10424 DNA repair and recombination proteins [BR:pno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      SNOG_10424    MMR (mismatch excision repair)      SNOG_10424   DSBR (double strand breaks repair)    HR (homologous recombination)      SNOG_10424 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 DUF5666 SH3_16 Motif Other DBs NCBI-GeneID:  5977601 NCBI-ProteinID:  XP_001800694 UniProt:  A0A7U2FFT4 Q0UCU0 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MDHPQTPRILAPHLSQFQHRIVRILGKVVQLRGETAVIDAGGNVDVVLNRDSHLAVGHAV EVIGKVDGNLNVKVQACTDWGTSVDFNAANAVVEATHRHKAIFYDGE NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggaccacccccaaaccccgcgcatcctcgccccgcacctctcccaattccagcaccgc atcgtgcgcatcctcggcaaagtcgtccaactgcgcggcgaaaccgccgtcatcgacgcc ggcggcaacgtggacgttgttttgaaccgcgactcgcacctggcggtcggccatgcggtc gaggttattgggaaagtcgatggcaatttgaatgtcaaggtgcaagcgtgcacggattgg gggacgagtgttgatttcaatgcggcaaatgcggttgttgaggctacgcataggcacaag gcgattttttatgatggggagtga

DBGET integrated database retrieval system