Paenibacillus naphthalenovorans: IJ22_29950
Help
Entry
IJ22_29950 CDS
T04167
Name
(GenBank) ABC transporter
Organism
pnp
Paenibacillus naphthalenovorans
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_22
AAA_30
AAA
DEAD
AAA_16
Zeta_toxin
DUF3584
AAA_25
AAA_29
RsgA_GTPase
nSTAND3
SbcC_Walker_B
AAA_15
AAA_23
Motif
Other DBs
NCBI-ProteinID:
ALS23368
UniProt:
A0A0U2UAY3
LinkDB
All DBs
Position
complement(2957555..2959387)
Genome browser
AA seq
610 aa
AA seq
DB search
MSDHPAGAFRAGGGLGGMRRFGSGEKAKPASIYGMFARIFTHARLEWPAIITAVVCVIAV
SLLEFVVPQLTRYTIDHLIPGKRFDGLVLIGAGVLGAAVMLGVLRYISTSLMASIGQKVL
YKLRNDLYRHMQSLDVSFFDRNRTGDLMSRVTHDVSILQQLISSSMMQLFTDFFTFTAIA
VYMLWIDWRLTLLLLAIFPVMILTTKLFGKRIRASFRKVQESIADVSDHLQNTLTGIRLI
KSFTAENYESERFSHRTRENMDANIQVVRLRAAYEPIIDFLNFTGLAIVLVFGAWLSMKG
QMTVGTIVAFTAYLRLLQNPIRHFSRVIHTIQQSAAAYERIMEVMNTKADIWEKEDAIAL
PPVRGHIVFRNVNFAYSRELEVLSGFNLELEAGKVTALVGSSGSGKTTIAHLIPRFYDPQ
AGDITIDGYSLKDVTLSSLREQIGIVSQDIVLFNGTIIENIRYSNSHATEEEVRAAAGAA
SASGFIEAFPQGYDTPIGERGVKLSGGQKQRISIARAILKNPRVIILDEATASLDTESEQ
HIQEALARLLKGRTCLVIAHRLSTIQQADRIHVLEQGRIVESGTHEELLRLQGRYSRLYA
LQFPQTKAVR
NT seq
1833 nt
NT seq
+upstream
nt +downstream
nt
atgagtgaccatccggcgggagccttccgggccggcggcggattgggaggcatgagaaga
ttcggcagcggcgagaaagccaagccggccagcatctacggtatgttcgcgcgaatcttt
acgcatgcgaggctggaatggccggctatcattacggcggtcgtgtgcgtgatcgccgtt
tcactgcttgaatttgtcgtcccccagcttacgcgctacacgatcgaccatctgattccc
ggcaagcgtttcgacgggctggttctgattggcgccggcgttctcggcgcggccgtcatg
ctgggcgtactgcgttatataagcacgtcgctgatggcctccatcgggcagaaggtgctc
tacaagctccgcaatgatctgtatcgccatatgcagagccttgatgtctcattttttgac
cgcaaccgcaccggggatctgatgtcccgcgtaacccatgacgtcagcatcttacagcag
ttgatctcttccagcatgatgcaattgtttaccgattttttcacgtttacagctatcgcg
gtgtatatgctctggattgattggaggctgacgctgctcctgcttgcgatcttcccggtt
atgattctgacgacgaagctgttcgggaaaagaattcgcgcttcgtttcgcaaggtgcag
gaatcgattgccgatgtgagcgaccatctgcaaaatacgctgaccggcatccggctgatc
aaatcgtttacggccgaaaactacgagtccgaacgattctcccatcgcaccagggaaaac
atggacgccaatattcaggtcgtccgcttgcgggccgcgtacgagccgattatcgatttt
cttaattttacgggattggctatcgtgcttgtgttcggggcctggctttcgatgaaggga
cagatgacggtaggcaccatcgtcgcttttaccgcttatttgcgcctgctgcaaaatccg
attcgccatttcagccgggtgatccatacgatccagcaatcggcggccgcgtatgaacgc
attatggaagtaatgaatacgaaggcggatatttgggagaaggaggacgcgattgcgctg
cctcccgtgcgcgggcatatcgtattccggaacgtgaattttgcttattcgcgcgagttg
gaagtgctgtccggattcaatctggagctggaggccggcaaggttacggctttggtcggt
tcatcgggctccggcaagacgacgatcgcgcatctgattccccgcttctacgatccgcaa
gccggggacattacgatagacggttactccctgaaggatgtgactctctcctcccttaga
gagcagatcggcatcgtatcgcaggatattgtattgttcaacgggacgatcatcgaaaac
atccgttacagcaacagccatgcgacggaagaggaggtcagggcggcagcgggggcggcc
agcgccagcggatttatcgaggctttcccgcagggatacgatacgccaatcggcgaacgc
ggcgtcaagctgtcgggcgggcaaaagcagcggatatccatcgcaagggccatcctgaaa
aatccgcgcgtcattattctcgatgaagcgacggcttcgctcgataccgaatcggagcag
catatccaggaagcgttggcgcggctgctgaaagggcgcacctgtctggtgatcgcccac
cggctatcgacgatccagcaggcggaccgcattcatgtgctggagcaaggccgcatcgtt
gagagcgggacgcacgaagagctgctgcgcctgcaaggccgctacagccggctctatgca
ttgcaatttccgcaaacgaaagcggtgagataa
DBGET
integrated database retrieval system