Paenibacillus naphthalenovorans: IJ22_50000
Help
Entry
IJ22_50000 CDS
T04167
Name
(GenBank) ATPase AAA
KO
K03924
MoxR-like ATPase [EC:3.6.3.-]
Organism
pnp
Paenibacillus naphthalenovorans
Brite
KEGG Orthology (KO) [BR:
pnp00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
IJ22_50000
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_3
bpMoxR
AAA_lid_2
AAA_5
AAA
RuvB_N
AAA_22
Sigma54_activat
Mg_chelatase
MCM
NPHP3_N
AAA_16
AAA_30
NACHT
TsaE
Motif
Other DBs
NCBI-ProteinID:
ALS25262
UniProt:
A0A0U2WFW2
LinkDB
All DBs
Position
4986862..4987851
Genome browser
AA seq
329 aa
AA seq
DB search
MIETREQVEAWGATITAVKEQIGRVIVGQQDVVEQLLWCIFAGGHALLEGIPGLGKTMLV
RTIADTLDMSFSRIQFTPDLMPADITGTNVIQFGLKGETSYQFQPGPIFGNLVLADEINR
ATPKTQSALLEAMQEKTVTVGAETHRLPNPFFVLATQNPLENEGTYPLPEAQLDRFLLKI
NVSYPSRDELKEIVRRTTASHEATAEKTADAAALSAIQQGVKEILLAEEVLDYAVQLTMM
THPGEQGVPDSVKKYVRFGSGPRGLQSIISAAKVRALTAGRLHVSVNDIQKVALPALRHR
IFLNFEGQAMGVGTDAVIEDILAAVEKRK
NT seq
990 nt
NT seq
+upstream
nt +downstream
nt
atgatagaaacaagagagcaagtcgaagcgtggggggcgacgatcactgcggtcaaggaa
cagatcggccgggtgatcgtcgggcagcaggatgtagtggagcagctgttgtggtgtatt
tttgcagggggacacgcattgcttgaagggataccgggactcggcaaaacgatgctggtg
cgaacgattgccgatacgctcgatatgagcttctcgcgcatccagtttacgcccgacctg
atgccggccgacatcacaggaacaaacgtaatccagttcggtttgaaaggtgaaacgtct
taccaatttcagccgggtccgattttcggcaatctcgtcctggccgatgagatcaacagg
gcgacgccgaagacgcaaagcgcgctgctggaagcgatgcaggagaagacggtgacagtc
ggggcggagacgcatcggctgccaaatccgtttttcgtgcttgcaacgcagaacccgctg
gagaacgaggggacgtatcctctgccggaggcgcagctcgaccggtttttgttaaaaatc
aacgtatcataccccagccgggacgagctgaaggagattgtccggcggacaacggcttcg
catgaagcgacggcggagaaaacggcggatgccgcggccttgtcggccatacagcagggg
gtcaaagaaatcctgctggctgaagaggtgctggattacgctgtacaactgacgatgatg
acgcatcccggagagcagggggtgccggactcggtgaaaaaatatgtacggttcggctcg
ggcccgcgcggtctgcagtcgatcatttccgcagccaaggtgagggcgctgacggccgga
aggctgcacgtatcggtgaacgacatccagaaggtggctctgccggcgctccgccatcgg
atcttcctgaactttgaaggtcaggcgatgggtgtgggaaccgatgcggtgattgaggat
atcttagccgcagtggagaagcggaaatga
DBGET
integrated database retrieval system