KEGG   Pandoraea norimbergensis: AT302_25640
Entry
AT302_25640       CDS       T04226                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:7.1.1.2]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00190  Oxidative phosphorylation
pnr01100  Metabolic pathways
Module
pnr_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT302_25640
Enzymes [BR:pnr01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     AT302_25640
SSDB
Motif
Pfam: Proton_antipo_M TMEM128 Oxidored_q5_N Monellin
Other DBs
NCBI-ProteinID: ALS62677
UniProt: A0ABN4JRG8
LinkDB
Position
complement(3997653..3999218)
AA seq 521 aa
MFPILSLLIWTPILAGALIMLLGQDRHPNAVRWTSLAAAVVAALPIIPLVRGFHTRVADM
QFVEHFRWITSFDASWHVGIDGLSLWLVALTGVTTIIVVLASWRAVTTRMSAYFGSFLVL
SGLMQGVFTAQDGMLFFVFFEATLLPLYLLIGVYGRANRTRAAVKFFFFSLTGSLMMLLS
MLYLYMQTQSFDIARWHELHLPLAVQVMLFIGFLGAFSVKVPMWPVHTWLPDVHLDGPTG
AAVMLGMLKMGGYGLLRFNLPLLPDASHFVAPVMVVLSLIAVIYASLVALVQTDLRKLLA
YSAVAHMGLVTLGLFLFSEMGTDGAVMQMISYGIVSGAMLLCTGMLYDRTGSSSIDAYGG
VAATMPRFAAFAMLFSMANVGMPGTSGFVGEFLVLMGAIKANFWIGALASLTLVLSAAYT
LWMYKRVIFGRVGNASVASLKDVSRREFALLGAMAVMVLAIGLDPKPLTDGIDATAIQVV
QGIEQHRLPANDPGSSEVAGRRHGDAAGRASVTVKGVQPAA
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtttcccatcctgtcgcttctaatctggacacccattctggccggcgcgctcatcatg
ctgctcgggcaggaccgccatcccaacgccgtacgctggacatcgctcgcggcagcggtg
gttgccgcattgccaatcattccgctcgtgcgcggctttcacacgcgcgtggccgatatg
cagtttgttgagcatttccgctggatcacgtcgttcgatgcgtcgtggcacgtcggtatc
gatggcctctcgctctggctcgtggcgttgaccggtgtgacgaccatcatcgtggtgctg
gcgtcgtggcgcgcagtgaccacgcgcatgagcgcgtacttcggcagcttcctcgtgctc
tccgggctgatgcagggggtgttcacggcgcaggacggcatgttgttcttcgtgttcttc
gaagccacgctgctgccgctgtatctgctcatcggcgtgtacgggcgtgccaatcgcacg
cgtgctgcggtgaagttcttcttcttctcgctgaccggctcgttgatgatgctgctctcg
atgctgtatctctacatgcagacgcagagcttcgatatcgcccgctggcacgaactgcat
ctgccgctggccgtgcaggtgatgctgtttatcggtttcctcggcgcgttttcggtcaag
gtgccgatgtggccggtgcacacgtggttgcccgacgttcacctcgatgggccgacgggt
gccgccgtgatgctcggcatgttgaagatgggcggctacggcctgctgcgattcaatctg
ccgctgctgccggatgctagccacttcgtcgcgccggtgatggtggtgctgtcgctgatc
gcggtgatttacgcgagcctcgtggcgttggtgcagaccgacttgcgcaagctgctcgcg
tattcggctgtagcgcacatggggctggtgacgctcggcttgtttctgttctcggaaatg
ggcaccgacggcgcggtgatgcagatgatttcgtacggcatcgtctcgggtgccatgctg
ctgtgcacgggcatgttgtacgaccgcaccggcagttcgtccatcgacgcgtacggtggc
gtggcggcgacgatgccgcgttttgcggcattcgcgatgctgttctcgatggccaacgtg
ggcatgccgggcacgtcgggtttcgtcggtgagtttctggtgttgatgggggccatcaag
gcgaacttctggatcggggcgctcgcctcgctgacgctggtgctcagtgcggcctacacg
ctgtggatgtacaagcgcgtgattttcggacgcgtcggcaatgcgagcgtggcgtcgctc
aaggatgtgagccgtcgcgagtttgcgctgctcggcgccatggcggtgatggtgctggcc
atcggtcttgatccgaagccgctcaccgacggtatcgacgcgacggcgattcaggtggta
caggggattgaacaacaccgtctgcccgccaacgatccgggcagcagcgaagtggcagga
cgccggcatggtgacgccgccggacgcgcttcggtgacggtgaagggtgtgcagccggca
gcctga

DBGET integrated database retrieval system