Pseudomonas nitroreducens: G5B91_21810 Help Entry G5B91_21810       CDS       T08828                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pnt  Pseudomonas nitroreducens Pathway pnt01100   Metabolic pathways pnt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B91_21810 (acpP)    00074 Mycolic acid biosynthesis     G5B91_21810 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B91_21810 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QIE88764 UniProt:  A0A246FCS8 LinkDB All DBs Position complement(4578843..4579079) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYIVAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgttgctgagcaactcggcgttaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccccgacgagcaagcc gaaaagatcaccaccgttcaggaagccatcgactacatcgttgcccaccaggcataa

DBGET integrated database retrieval system