Pseudomonas nitroreducens: G5B91_30305 Help Entry G5B91_30305       CDS       T08828                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pnt  Pseudomonas nitroreducens Brite KEGG Orthology (KO) [BR:pnt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pnt03110]     G5B91_30305 (grxC) Chaperones and folding catalysts [BR:pnt03110]  Protein folding catalysts   Protein disulfide isomerase    G5B91_30305 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_3 GST_N TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  QIE90314 UniProt:  A0A6G6J4Z9 LinkDB All DBs Position complement(6370741..6370995) Genome browser AA seq 84 aa AA seqDB search MPSTLIYTSAWCPYCIRAKALLDKKGVAYEEISVDGKPGVRAEMASKAGRTSVPQIWIDG THIGGCDDLYALERAGKLDTLLSA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccgtcgaccttgatctacaccagcgcgtggtgcccttattgcatccgcgccaaggcc ctgctggacaagaagggtgtcgcctacgaggaaatctccgtggacggcaagcctggcgtt cgcgccgagatggccagcaaggcgggccgcacttcggtgccgcagatctggatcgacgga acccacatcggcggctgcgacgatctttacgcgctggaacgcgcgggcaagctggatacg ctgctctcggcgtga

DBGET integrated database retrieval system