Polynucleobacter asymbioticus: Pnuc_0160 Help Entry Pnuc_0160         CDS       T00502                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism pnu  Polynucleobacter asymbioticus Brite KEGG Orthology (KO) [BR:pnu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pnu03036]     Pnuc_0160 Chromosome and associated proteins [BR:pnu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Pnuc_0160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL MAPEG Motif Other DBs NCBI-ProteinID:  ABP33381 UniProt:  A4SV67 LinkDB All DBs Position 153292..153558 Genome browser AA seq 88 aa AA seqDB search MNRATLTLLALLLVCALSLVAAQQRARKLFIAQERAQIEERKLNQEWLRLEYEQRNLSKS ARIRDVARNQLHMFPISPERTLYLKEAK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaatcgcgctactctgaccttattagctctgttgctcgtatgcgcgctttcattggta gctgcgcagcaacgtgcacgtaaattatttattgctcaagagcgtgcccaaattgaagag cgcaagcttaatcaagaatggctgcgtctagagtatgaacagcgcaatctttcgaaatct gcacgtattcgtgacgttgcgcgcaatcaattacatatgttccccatctctcctgaacgt actttgtacctaaaggaggctaaatga

DBGET integrated database retrieval system