Polynucleobacter asymbioticus: Pnuc_0401 Help Entry Pnuc_0401         CDS       T00502                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pnu  Polynucleobacter asymbioticus Pathway pnu01100   Metabolic pathways pnu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pnuc_0401    00074 Mycolic acid biosynthesis     Pnuc_0401   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pnuc_0401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  ABP33621 UniProt:  A4SVV7 LinkDB All DBs Position 392212..392451 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEGDIKNESSFVNDLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDFATSKAQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgttaagaaaatcgtcgctgagcaattgggcgtcgcagaa ggagatatcaaaaatgaatcttctttcgtgaacgacttgggcgctgactctcttgacact gttgagctggttatggctttggaagatgaattcggtatcgaaattcctgatgaggaagct gaaaagatcaccacagttcagctcgcgatcgacttcgctacatcaaaagctcagggttaa

DBGET integrated database retrieval system