Pseudodesulfovibrio nedwellii: SYK_00600 Help Entry SYK_00600         CDS       T09024                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism pnw  Pseudodesulfovibrio nedwellii Pathway pnw02020   Two-component system pnw02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pnw00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SYK_00600  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     SYK_00600    02026 Biofilm formation - Escherichia coli     SYK_00600   09142 Cell motility    02040 Flagellar assembly     SYK_00600  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pnw02035]     SYK_00600 Bacterial motility proteins [BR:pnw02035]  Flagellar system   Flagellar assembly proteins    Others     SYK_00600 SSDB OrthologParalogGFIT Motif Pfam:  FlgM HpcH_C Motif Other DBs NCBI-ProteinID:  BDQ35700 UniProt:  A0ABM8AVX6 LinkDB All DBs Position complement(61194..61502) Genome browser AA seq 102 aa AA seqDB search MVIKNIVGDQNPYANKKIERPQAKDPQHTQETSKGSGEVADRVVLSSEGRLRGAALQTAN EAPDVRRKKVDELKKQVQDGSYKPDLKKAAANLIRDDLDLLV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggttatcaagaatattgtaggggatcagaacccttacgcaaacaagaagatcgaacgg ccacaggccaaggatccgcagcacacgcaggaaacctccaagggttccggtgaagttgcc gaccgagtagtcctgtcctccgaaggtcgactgcggggtgcagcccttcagacggcaaac gaagcacctgatgtccgccgtaaaaaagtggatgagctcaaaaagcaggttcaagatggt tcttacaagccggacctgaaaaaggccgccgcgaatctcattcgtgacgacctcgatctt ctcgtttaa

DBGET integrated database retrieval system