Pseudodesulfovibrio nedwellii: SYK_01740 Help Entry SYK_01740         CDS       T09024                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pnw  Pseudodesulfovibrio nedwellii Pathway pnw00020   Citrate cycle (TCA cycle) pnw00720   Other carbon fixation pathways pnw01100   Metabolic pathways pnw01110   Biosynthesis of secondary metabolites pnw01120   Microbial metabolism in diverse environments pnw01200   Carbon metabolism pnw01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pnw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYK_01740   09102 Energy metabolism    00720 Other carbon fixation pathways     SYK_01740 Enzymes [BR:pnw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYK_01740 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_6 Fer4_4 Fer4_8 Fer4_17 LdpA_Fe-S-bd Fer4_13 Fer4_22 Fer4_15 Fer4_3 Fer4_ETF_QO Motif Other DBs NCBI-ProteinID:  BDQ35814 UniProt:  A0ABN6RXS9 LinkDB All DBs Position 196470..196757 Genome browser AA seq 95 aa AA seqDB search MARKNKGKNKVTVYPDWCKGCGICVEFCPGKVLELNDQGKSSVVHEENCIRCGFCELHCP DFAIVVKDKDPESGKKAAKEAEFKAAKKNITGKGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctagaaaaaacaaagggaagaacaaggttaccgtgtacccggactggtgcaaaggc tgcggcatctgtgtcgagttttgtccgggcaaggtgcttgagttgaatgatcaagggaaa tcctcggttgttcacgaagagaactgtatccgttgcggcttttgcgagttgcactgtccc gattttgctatcgtggtcaaagacaaggatcccgagagcggcaaaaaggctgccaaggaa gcggaattcaaggctgccaaaaagaacataaccgggaagggggcgtaa

DBGET integrated database retrieval system