Pseudodesulfovibrio nedwellii: SYK_15420 Help Entry SYK_15420         CDS       T09024                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pnw  Pseudodesulfovibrio nedwellii Pathway pnw00020   Citrate cycle (TCA cycle) pnw00720   Other carbon fixation pathways pnw01100   Metabolic pathways pnw01110   Biosynthesis of secondary metabolites pnw01120   Microbial metabolism in diverse environments pnw01200   Carbon metabolism pnw01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pnw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYK_15420   09102 Energy metabolism    00720 Other carbon fixation pathways     SYK_15420 Enzymes [BR:pnw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYK_15420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_4 Fer4_21 Fer4_2 Fer4_10 Fer4_17 Fer4_6 Fer4_16 Fer4_3 Fer4_8 LdpA_Fe-S-bd Fer4_22 Fer4_18 DUF2719 Fer4_13 Motif Other DBs NCBI-ProteinID:  BDQ37182 UniProt:  A0ABM8B0T2 LinkDB All DBs Position complement(1674265..1674486) Genome browser AA seq 73 aa AA seqDB search MKAKNKKHVICAERCKSCGLCVEACPKDTLAIGQTLNGQGYNVVEQVRPEDCVLCGLCRI VCPDVAIGVVELD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaagccaagaataaaaagcacgttatttgcgccgaacgctgcaagtcttgcggtttg tgcgttgaagcttgccccaaggatacccttgccatcggtcagaccttgaatggtcaagga tataacgttgttgaacaggtccgtcctgaagattgtgtcctgtgcggcctgtgtcgcatc gtctgtcctgatgtcgccatcggcgtcgtcgagttggactaa

DBGET integrated database retrieval system