Pseudodesulfovibrio nedwellii: SYK_17930 Help Entry SYK_17930         CDS       T09024                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pnw  Pseudodesulfovibrio nedwellii Pathway pnw01100   Metabolic pathways pnw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SYK_17930 (acpP)    00074 Mycolic acid biosynthesis     SYK_17930 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SYK_17930 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  BDQ37433 UniProt:  A0ABM8B0X2 LinkDB All DBs Position complement(1960140..1960373) Genome browser AA seq 77 aa AA seqDB search MSDVAAKVKEIIVEQLGVSADEVVEGAAFVEDLGADSLDLTELIMAMEEEFDVEIDDEEA QKILKVSDAISHIEKAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgtagcagcaaaagtgaaagagattattgttgagcagcttggtgtgtccgca gacgaagtcgttgaaggcgcagcatttgttgaagatctgggtgcagactctttggacctg accgaactgatcatggccatggaagaagagtttgacgtggaaatcgacgatgaggaagct cagaaaatcctcaaagtcagtgacgctatttctcatatcgagaaagctcaatag

DBGET integrated database retrieval system