Populus nigra (Lombardy poplar): 133678866 Help Entry 133678866         CDS       T10372                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03083   Polycomb repressive complex pnz04120   Ubiquitin mediated proteolysis pnz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133678866    04120 Ubiquitin mediated proteolysis     133678866   09126 Chromosome    03083 Polycomb repressive complex     133678866  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pnz04131]     133678866    04121 Ubiquitin system [BR:pnz04121]     133678866    03036 Chromosome and associated proteins [BR:pnz03036]     133678866 Membrane trafficking [BR:pnz04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     133678866 Ubiquitin system [BR:pnz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      133678866    Cul7 complex      133678866 Chromosome and associated proteins [BR:pnz03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      133678866   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      133678866 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ HTH_Tnp_IS630 CCDC74_C Motif Other DBs NCBI-GeneID:  133678866 NCBI-ProteinID:  XP_061957359 LinkDB All DBs Position 18:complement(9992049..9992513) Genome browser AA seq 154 aa AA seqDB search MACSETTTKVLKLKTSDNEVVEVEEKAALQSEIIKSMVEDGHSTDDAIPLFKVEKKTLAK IVEWLKKHASDASKDELDKWDADFLDVDTDFLYDLLLASNYLSIEVLLGQLTQKVADMIT RNQPIKIRELFNIKNDFTPEEKEEILKENSWLFN NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcatgttcagagactacaactaaggttttgaagttgaaaaccagtgacaatgaagtt gttgaggtggaagagaaggctgccttacaatctgaaatcatcaagagcatggttgaagat ggccatagtactgatgatgcgattccactcttcaaagtagaaaagaaaaccctagccaag attgtggagtggttgaagaagcatgcgagcgatgcatctaaggatgagcttgataagtgg gatgctgattttttagatgttgacacagattttctctatgatcttctcctagcttcgaac tatctcagcattgaagttttgcttggccaacttacacaaaaagttgcagacatgatcaca aggaatcaacctattaaaattcgcgaactctttaatatcaagaacgattttaccccagag gaaaaggaagaaattctcaaggagaattcatggttattcaattga

DBGET integrated database retrieval system