Populus nigra (Lombardy poplar): 133679230 Help Entry 133679230         CDS       T10372                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03083   Polycomb repressive complex pnz04120   Ubiquitin mediated proteolysis pnz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133679230    04120 Ubiquitin mediated proteolysis     133679230   09126 Chromosome    03083 Polycomb repressive complex     133679230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pnz04131]     133679230    04121 Ubiquitin system [BR:pnz04121]     133679230    03036 Chromosome and associated proteins [BR:pnz03036]     133679230 Membrane trafficking [BR:pnz04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     133679230 Ubiquitin system [BR:pnz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      133679230    Cul7 complex      133679230 Chromosome and associated proteins [BR:pnz03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      133679230   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      133679230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  133679230 NCBI-ProteinID:  XP_061957751 LinkDB All DBs Position 19:11692853..11694563 Genome browser AA seq 158 aa AA seqDB search MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAENDIPLPNVTSKILAKVIEYC KKHVEADADKDATITGKDDFMKSWDAEFIKVDKNTLFDLILAANYLNIKDLLDLTCQAAA DMIKGKTPDEIRKIFNIKNDFTPEEEEQIRKDNQWAFK NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcagaatcaaagaaaatcacgctaaaatcctccgacggcgagacattcgttgtcgaa gaagcggtcgccgttgagtcacagaccatcaaacatatgattgaagatgattgcgcagaa aatgacatcccgttgcctaatgtgacaagcaagattcttgctaaggttatcgagtactgc aagaaacatgtggaagctgatgctgataaagatgcgactattactggaaaggatgacttt atgaagagttgggatgccgagttcatcaaagttgacaaaaacaccctctttgacctcatc ttggctgcaaactatctgaacatcaaggatttgctagatctgacctgccaggctgcggct gacatgatcaaggggaagactccagacgagatccgtaagatatttaacatcaagaatgac ttcactccagaagaagaagagcagatccgcaaagacaaccagtgggcatttaagtga

DBGET integrated database retrieval system