Populus nigra (Lombardy poplar): 133694638 Help Entry 133694638         CDS       T10372                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03018   RNA degradation pnz03040   Spliceosome Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     133694638   09123 Folding, sorting and degradation    03018 RNA degradation     133694638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pnz03019]     133694638    03041 Spliceosome [BR:pnz03041]     133694638 Messenger RNA biogenesis [BR:pnz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      133694638   mRNA degradation factors    5'-3' decay     Lsm complex      133694638 Spliceosome [BR:pnz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     133694638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM RVT_2 Motif Other DBs NCBI-GeneID:  133694638 NCBI-ProteinID:  XP_061972237 LinkDB All DBs Position 1:21415104..21417759 Genome browser AA seq 98 aa AA seqDB search MSIGTGLESLVDQTISIITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLG LYIIRGDNIGVVGELDEELDAHLDLSSLRAHPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctattggaacaggactcgagtctctcgtagatcaaacaatttcaattatcacaaat gatggccggaatatagtgggagtcttaaaaggctttgaccaggccacaaatattatcctt gatgaatctcacgagcgtgtttactccaccaaggaaggtgttcaacaactagtgttgggc ttgtacataataaggggtgacaacataggcgttgttggggaacttgatgaagagcttgat gcgcaccttgacttgtctagtctgagagctcatccactcaagcctgtcattcattga

DBGET integrated database retrieval system