Populus nigra (Lombardy poplar): 133701091 Help Entry 133701091         CDS       T10372                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03018   RNA degradation pnz03040   Spliceosome Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     133701091   09123 Folding, sorting and degradation    03018 RNA degradation     133701091  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pnz03019]     133701091    03041 Spliceosome [BR:pnz03041]     133701091 Messenger RNA biogenesis [BR:pnz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      133701091   mRNA degradation factors    5'-3' decay     Lsm complex      133701091 Spliceosome [BR:pnz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     133701091  Complex C   U2 snRNP components     133701091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  133701091 NCBI-ProteinID:  XP_061980870 LinkDB All DBs Position 8:complement(1464902..1467170) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDVDLLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgtttttttcgtatttcaaggatttggtagggaaagaagtgacggtggagctgaag aatgatttggctataagagggactcttcactctgtggatcagtacctcaacatcaagctc gaaaacactcgcgttgtcgatcaagacaagtatcctcacatgctttctgtcaggaactgt ttcataaggggatcagtagtgagatatgttcaacttcctccagagggtgtggatgttgat ctgcttcacgatgccacgagaagggaagctcggggtggctga

DBGET integrated database retrieval system