Populus nigra (Lombardy poplar): 133704300 Help Entry 133704300         CDS       T10372                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pnz  Populus nigra (Lombardy poplar) Brite KEGG Orthology (KO) [BR:pnz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pnz03041]     133704300   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pnz04052]     133704300 Spliceosome [BR:pnz03041]  Complex B   Other components    Complex B specific factors     133704300 Cytokines and neuropeptides [BR:pnz04052]  Neuropeptides   Unclassified    133704300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Rad60-SLD Motif Other DBs NCBI-GeneID:  133704300 NCBI-ProteinID:  XP_061985080 LinkDB All DBs Position 10:14408891..14410260 Genome browser AA seq 73 aa AA seqDB search MLEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttggaggtggtgttgaacgatcgtttgggaaagaaagtgagagtgaagtgcaacgac gacgacacgatcggcgacctcaagaagctcgtggcggcacagaccggtacccgagctgag aagatccggatccagaagtggtacaacatctataaagaccatattaccctcaaggattac gagattcatgatggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system