Segatella oris: NCTC13071_00342 Help Entry NCTC13071_00342   CDS       T06067                                  Name (GenBank) Ferredoxin III   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism poc  Segatella oris Pathway poc00020   Citrate cycle (TCA cycle) poc00720   Other carbon fixation pathways poc01100   Metabolic pathways poc01110   Biosynthesis of secondary metabolites poc01120   Microbial metabolism in diverse environments poc01200   Carbon metabolism poc01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:poc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NCTC13071_00342   09102 Energy metabolism    00720 Other carbon fixation pathways     NCTC13071_00342 Enzymes [BR:poc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NCTC13071_00342 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_4 LdpA_Fe-S-bd Fer4_16 Fer4_15 Fer4_17 Fer4_3 Fer4_8 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  VEH14371 UniProt:  A0A3S5EP47 LinkDB All DBs Position 1:388494..388724 Genome browser AA seq 76 aa AA seqDB search MGKVVGAIVVNEDRCKGCSLCVVACPKAVIALADRKVNVSGYPFAEAVRPDDCIGCASCA IVCPDGCITVYRKKLD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggaaaagtagttggtgccatcgtggtaaacgaggaccggtgtaagggctgttcgctt tgtgttgtggcctgtccgaaagccgttatcgccttggctgatagaaaagtcaacgtaagc ggatatccgtttgccgaagctgtccgtccggatgactgcataggttgtgcatcttgtgct atcgtttgtcccgacggatgcattactgtctatcgaaagaaacttgattaa

DBGET integrated database retrieval system