Pontibacillus sp. HMF3514: GS400_09010 Help Entry GS400_09010       CDS       T06374                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pof  Pontibacillus sp. HMF3514 Pathway pof01100   Metabolic pathways pof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GS400_09010 (acpP)    00074 Mycolic acid biosynthesis     GS400_09010 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GS400_09010 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc DUF7080 DUF1493 UPA_2 Motif Other DBs NCBI-ProteinID:  QHE52159 UniProt:  A0A6P1HGJ6 LinkDB All DBs Position 1740777..1741013 Genome browser AA seq 78 aa AA seqDB search MADVLERVKGIVAERLDVEQSKITMEASFKDDLEADSLDVVELVMELEDEFDMEISDEDA EKIETVGDAVNYINSHQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagaacgtgtaaaaggtattgttgcagagcgtcttgatgtagaacag tctaaaatcacaatggaagcttctttcaaagatgatctagaagcagactctcttgatgtg gttgagcttgtaatggagcttgaagatgagttcgacatggaaatctctgacgaagatgct gaaaagattgaaacggtaggcgatgctgttaactacataaacagtcatcaatcataa

DBGET integrated database retrieval system