Pontibacillus sp. HMF3514: GS400_10990 Help Entry GS400_10990       CDS       T06374                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pof  Pontibacillus sp. HMF3514 Brite KEGG Orthology (KO) [BR:pof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pof03032]     GS400_10990    03036 Chromosome and associated proteins [BR:pof03036]     GS400_10990    03400 DNA repair and recombination proteins [BR:pof03400]     GS400_10990 DNA replication proteins [BR:pof03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GS400_10990 Chromosome and associated proteins [BR:pof03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GS400_10990 DNA repair and recombination proteins [BR:pof03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GS400_10990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg DUF2267 SIS_2 HU-CCDC81_euk_1 Glycos_trans_3N Motif Other DBs NCBI-ProteinID:  QHE52523 UniProt:  A0A6P1HKP2 LinkDB All DBs Position complement(2130534..2130806) Genome browser AA seq 90 aa AA seqDB search MNKTDLINAVAEKSELSKKDATQAVDAVIESITDSLKDGEKVQLIGFGNFEVRERAARKG RNPQSGEEIEISASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagactgatctaatcaatgcagttgctgaaaagagtgaactgtctaaaaaagat gctacacaagctgttgatgcagttattgaatctatcacagattcacttaaagacggtgaa aaagtacaactaattggtttcggaaactttgaagtacgtgaacgtgcagctcgtaaaggt cgtaacccacaatcaggtgaggaaatcgaaatttcagctagcaaggttcctgcattcaaa ccaggaaaagcccttaaagatgctgttaaataa

DBGET integrated database retrieval system