Pseudomonas orientalis: BOP93_02030 Help Entry BOP93_02030       CDS       T05323                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poi  Pseudomonas orientalis Pathway poi01100   Metabolic pathways poi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BOP93_02030    00074 Mycolic acid biosynthesis     BOP93_02030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BOP93_02030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUZ44398 UniProt:  A0A2L0RR02 LinkDB All DBs Position complement(486733..487002) Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKLLIIEALGLEDISADDIGSDQTLFGEGLGLDSVDALELGLAIQKTYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgatataaagctgctgatcatcgaggccctgggc ctggaagacatcagcgccgacgacatcggcagcgaccagaccctgttcggcgaaggcctg ggcctggactcggtcgacgccctggagctgggtctggccatccagaaaacgtacggcatc aagatcgatgccgacgccaaggacacgcgcaatcacttcaccaacgtggccagccttgcg gcattcgtcacagccagacaggcagcttga

DBGET integrated database retrieval system