Pseudomonas orientalis: BOP93_02415 Help Entry BOP93_02415       CDS       T05323                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism poi  Pseudomonas orientalis Pathway poi02024   Quorum sensing poi03018   RNA degradation Brite KEGG Orthology (KO) [BR:poi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BOP93_02415  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BOP93_02415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:poi03019]     BOP93_02415    03036 Chromosome and associated proteins [BR:poi03036]     BOP93_02415 Messenger RNA biogenesis [BR:poi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BOP93_02415 Chromosome and associated proteins [BR:poi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BOP93_02415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AUZ44475 UniProt:  A0A0R3A1E6 LinkDB All DBs Position 586599..586859 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAGDEAADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaataccttacgtaaagagaaagtg ggggtttccatttatctggtcaacggtatcaagttgcaaggtacgatcgagtcgttcgac cagttcgtgatcctgctgaaaaacaccgtcagccagatggtttacaaacacgctatctcg acagtcgtccctgttcgtccaatccgtctgcctagcgcagccggtgatgaagcagctgac gctgagccaggtaacgcctga

DBGET integrated database retrieval system