Pseudomonas orientalis: BOP93_05050 Help Entry BOP93_05050       CDS       T05323                                  Name (GenBank) dipicolinate synthase   KO K03530   DNA-binding protein HU-beta Organism poi  Pseudomonas orientalis Brite KEGG Orthology (KO) [BR:poi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:poi03032]     BOP93_05050    03036 Chromosome and associated proteins [BR:poi03036]     BOP93_05050    03400 DNA repair and recombination proteins [BR:poi03400]     BOP93_05050 DNA replication proteins [BR:poi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BOP93_05050 Chromosome and associated proteins [BR:poi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BOP93_05050 DNA repair and recombination proteins [BR:poi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BOP93_05050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 SSPI Motif Other DBs NCBI-ProteinID:  AUZ44975 UniProt:  A0A0R2ZUZ4 LinkDB All DBs Position 1164039..1164320 Genome browser AA seq 93 aa AA seqDB search MALTKDQLIADIAEAIDAPKTTARAALDQLGQIVADQLENGGEITLPGIGKLKVTERPAR TGRNPSTGAAIEIAAKKVIKLVVAKGLTDAVNK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctttgactaaagaccaactgatcgctgatatcgctgaagctatcgacgcgccgaaa accaccgcgcgcgcagcgctggaccaactgggccagatcgttgccgatcagctggaaaac ggcggcgaaatcactctgccaggtatcggcaagctgaaagtgaccgagcgtcctgcccgt accggccgtaacccttcgactggcgctgccatcgaaatcgctgccaagaaagttatcaag ctggttgtggccaaaggcctgaccgacgctgttaacaagtaa

DBGET integrated database retrieval system