Metapseudomonas otitidis: PtoMrB4_02530 Help Entry PtoMrB4_02530     CDS       T06890                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism poj  Metapseudomonas otitidis Brite KEGG Orthology (KO) [BR:poj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:poj03036]     PtoMrB4_02530 Chromosome and associated proteins [BR:poj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PtoMrB4_02530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB SOGA1-2-like_CC USHBP1_PDZ-bd Matrilin_ccoil Trehalose_recp Asd-4 DUF2205 NRBF2 DUF7603 Neuromodulin_N Motif Other DBs NCBI-ProteinID:  BCA26276 UniProt:  A0A1I0SJ08 LinkDB All DBs Position complement(252683..252892) Genome browser AA seq 69 aa AA seqDB search MEDADLKALATRLEHLIQRVEQLKAHNRQLLANERMWKEERAHLIEKNELARQKVEAMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagatgccgacctgaaagcactcgccacccgcctggaacacctgatccagcgcgtg gagcagctcaaggcgcacaaccggcaactgctcgcgaacgagaggatgtggaaagaagaa cgcgctcatctgatcgaaaagaacgaactggcccggcagaaggtcgaagcgatgatttcg cgcctgaaagccctggagcaggattcatga

DBGET integrated database retrieval system