Metapseudomonas otitidis: PtoMrB4_06310 Help Entry PtoMrB4_06310     CDS       T06890                                  Name (GenBank) hypothetical protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism poj  Metapseudomonas otitidis Brite KEGG Orthology (KO) [BR:poj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:poj03016]     PtoMrB4_06310   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:poj04147]     PtoMrB4_06310 Transfer RNA biogenesis [BR:poj03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     PtoMrB4_06310 Exosome [BR:poj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PtoMrB4_06310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Motif Other DBs NCBI-ProteinID:  BCA26654 UniProt:  A0A679GKZ6 LinkDB All DBs Position complement(671944..672177) Genome browser AA seq 77 aa AA seqDB search MHFLVIPKRHIETLNHLTEDDRELAGHILFTAQRLAREQGCEEGFRVVMNCNELGGQTVY HIHMHVLGLRQLDWPPG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgcacttcctggtcatcccaaagcgacacatcgaaaccctcaaccatctcaccgaggat gaccgcgagctggccggccacatcctgttcacggcacagcgcctggcccgggaacagggc tgcgaggaaggcttccgcgtggtgatgaactgcaacgaactgggcgggcagacggtctat cacatccatatgcacgtgctcggactgcgccagctggactggcccccgggctga

DBGET integrated database retrieval system