Pseudomonas otitidis: PtoMrB4_43410 Help Entry PtoMrB4_43410     CDS       T06890                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism poj  Pseudomonas otitidis Brite KEGG Orthology (KO) [BR:poj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:poj03036]     PtoMrB4_43410 (ftsB) Chromosome and associated proteins [BR:poj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PtoMrB4_43410 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 bZIP_1 YabA ZapB Motif Other DBs NCBI-ProteinID:  BCA30364 UniProt:  A0A1I0UKZ2 LinkDB All DBs Position complement(4706872..4707153) Genome browser AA seq 93 aa AA seqDB search MAKSPYWLFVVLILALSGLQYRLWVGDGSLAQVAELEKQIAEQKGENERLLERNRILEAE VSELKKGTETVEERARHELGMVKEGETLYQITE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccaaatccccctactggttgttcgttgtactgatcctggccttgtccgggttgcag tatcgcctctgggtgggtgatggcagcctcgcccaagtcgccgaactggaaaagcagatc gccgagcagaagggcgagaacgagcgcctgctcgagcgcaatcgcatcctcgaggccgag gtgtcggagctcaagaagggtacggaaaccgtcgaggagcgtgcccgccatgagctgggc atggtcaaagagggcgagaccctctaccagatcaccgaatga

DBGET integrated database retrieval system