Metapseudomonas otitidis: PtoMrB4_50660 Help Entry PtoMrB4_50660     CDS       T06890                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism poj  Metapseudomonas otitidis Pathway poj02024   Quorum sensing poj03018   RNA degradation Brite KEGG Orthology (KO) [BR:poj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PtoMrB4_50660 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PtoMrB4_50660 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:poj03019]     PtoMrB4_50660 (hfq)    03036 Chromosome and associated proteins [BR:poj03036]     PtoMrB4_50660 (hfq) Messenger RNA biogenesis [BR:poj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PtoMrB4_50660 (hfq) Chromosome and associated proteins [BR:poj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PtoMrB4_50660 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  BCA31089 UniProt:  A0A1I0UDC6 LinkDB All DBs Position complement(5474967..5475221) Genome browser AA seq 84 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSASEQEQPEPGNA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaataccttgcgtaaggaacgcgta ccggtttccatctacttggtcaacggcatcaagctgcagggccagatcgaatccttcgac cagttcgtgatcctgctgaagaacaccgtcagccagatggtctacaaacacgccatttcc accgttgtaccgagccgccccgtccgcctgcccagcgccagcgaacaagagcagcctgag cccggtaacgcctga

DBGET integrated database retrieval system