Metapseudomonas otitidis: PtoMrB4_51770 Help Entry PtoMrB4_51770     CDS       T06890                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism poj  Metapseudomonas otitidis Pathway poj01100   Metabolic pathways poj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:poj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PtoMrB4_51770    00074 Mycolic acid biosynthesis     PtoMrB4_51770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PtoMrB4_51770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GRIN_C Motif Other DBs NCBI-ProteinID:  BCA31200 UniProt:  A0A1I0UVM6 LinkDB All DBs Position 5614642..5614902 Genome browser AA seq 86 aa AA seqDB search MSALQLEIKNLIIEALGLEDIGPQDIGDEQTLFGEGLGLDSVDALELGLAIQKRFGIKID AEAKDTRKHFANVASLAAFVSAQKAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgctctgcaacttgagatcaagaacctgatcatcgaggccctcggcctcgaagac atcggcccgcaagacatcggcgacgagcagaccctgttcggcgaaggcctcggcctggac tcggtggacgccctggaactgggcctggccatccagaaacgcttcggcatcaagatcgac gccgaagccaaggacacccgcaaacactttgccaacgtggccagcctcgcggccttcgtg tcggcacagaaagccgcctga

DBGET integrated database retrieval system