KEGG   Pseudarthrobacter oxydans: SMD14_12090
Entry
SMD14_12090       CDS       T09608                                 
Symbol
ffh
Name
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
pok  Pseudarthrobacter oxydans
Pathway
pok02024  Quorum sensing
pok03060  Protein export
pok03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pok00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SMD14_12090 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMD14_12090 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMD14_12090 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pok02044]
    SMD14_12090 (ffh)
Enzymes [BR:pok01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     SMD14_12090 (ffh)
Secretion system [BR:pok02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SMD14_12090 (ffh)
  Eukaryotic Sec-SRP protein
   SMD14_12090 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N AAA_22 CbiA APS_kinase nSTAND3 AAA_30 Zeta_toxin cobW Thymidylate_kin AAA_16 AAA_18 NPHP3_N 6PF2K Mg_chelatase ATP_bind_1 DUF285 MeaB MobB NB-ARC AAA_31 TsaE AAA_33 DUF6596 TAF4 GT-D Chlamy_scaf
Other DBs
NCBI-ProteinID: WPU07921
LinkDB
Position
complement(2677470..2679053)
AA seq 527 aa
MFNSLSDRLTATFKNLRGKGRLSEADVDATVREIRRALLDADVAVPVVREFTGRVRERAL
GSEVSGALNPSQQIVKIVNEELVEILGGETRRIRLAKNGPTIIMLAGLQGAGKTTLAGKL
SKWLKAQGHSPMLVACDLQRPNAVTQLQVVGQRAKVPVFAPHPGATSSELEHPAGDPVAV
ARAGVEEARQKLHDVVIVDTAGRLGVDADMMEQARQIRRAIVPNEVLFVIDSMIGQDAVN
TALAFDEGVNFTGIVLSKLDGDARGGAALSVASVTGKPVMFASTGEGLDDFELFHPDRMA
SRILDMGDVLTLIEQAEKSWDKDEAARMAKKFADQEDFTLEDFLAQMQQIRNMGSMKKML
MMMPGAQNIRQQLEQFDEREIDRVEAIVRSMTPHERVAPKIINGSRRARIARGSGVHVSE
VNGLLERFAQAQKMMKKMAQGGMPGMPGMPGMPGAGGGARKNAKNAPKKKAKSGNPAKAA
QERKDAEARRANAAKALPTGAAFGQQPGDFDPSQLNLPKGFDKFLGK
NT seq 1584 nt   +upstreamnt  +downstreamnt
gtgttcaattcactctctgaccggttgacagcaacctttaagaatctgcggggtaaaggc
aggctctccgaggccgacgtcgatgccacagtccgcgagatccgccgtgccctcctggat
gccgacgttgccgttccagttgtccgtgaattcaccggccgggtacgggaacgcgccctg
ggttccgaggtgtccggtgcgctgaacccgagccagcagatcgtcaagatcgtcaacgaa
gaactggtggagatcctcggcggtgaaacccgccggatccgcctcgccaagaacggcccc
accatcatcatgctggctggcctccagggtgccggtaagaccaccctcgccggcaagctg
tccaagtggctgaaggcccagggccacagccccatgctggtggcatgcgacctgcagcgc
cccaacgcggtcacccagctccaggtggtgggccagcgcgccaaggtgccggtgttcgcg
ccgcacccgggagccacgtcctccgaactcgagcaccctgccggcgaccccgtggccgtt
gcccgcgccggtgtggaggaagcccgccagaagctgcacgacgtcgtcatcgtggacacc
gccggccggctcggtgtcgacgccgacatgatggagcaggcgcgccagatccgccgcgcc
atcgtgcccaacgaagtcctcttcgtcatcgactccatgatcggccaggacgccgtgaac
acggcgctcgccttcgatgagggcgtcaacttcacgggcatcgtgctctccaagctcgac
ggcgacgcccgcggcggtgccgcgctctcggtggcgtccgtcaccggcaaacccgtcatg
ttcgcctccaccggcgaaggccttgacgacttcgagctgttccacccggaccggatggca
tcgcgcatcctggacatgggtgacgtcctgacgctgattgagcaggcggagaaatcctgg
gacaaggacgaagccgcccggatggcgaagaaattcgccgaccaggaagacttcaccctt
gaggacttcctggcccagatgcagcagatccgcaacatgggctcgatgaagaaaatgctc
atgatgatgccgggtgcgcagaacatccgccagcagctggagcagttcgacgaacgcgag
atcgaccgcgtcgaggccatcgtccggtccatgaccccgcacgagcgtgttgcgcccaag
atcatcaacggctcccgccgcgcccgtattgcccgcggctccggcgtccacgtctccgag
gtcaacggccttctggagcgcttcgcccaggcccagaagatgatgaagaagatggcccag
ggcggcatgccggggatgcccgggatgccaggcatgccgggtgccggcggcggggcgcgg
aagaacgccaagaacgcccccaagaagaaggcgaagtcaggcaaccccgccaaggctgcc
caggagcggaaggacgccgaggcccgccgggccaacgcggccaaggctctgccgaccggc
gccgccttcggccagcagccgggcgacttcgatccgtcccagctgaacctgcccaagggc
ttcgacaagttcctcggcaagtaa

DBGET integrated database retrieval system