Polaromonas sp. JS666: Bpro_1460 Help Entry Bpro_1460         CDS       T00343                                  Name (GenBank) ribose-5-phosphate isomerase   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism pol  Polaromonas sp. JS666 Pathway pol00030   Pentose phosphate pathway pol00051   Fructose and mannose metabolism pol00710   Carbon fixation by Calvin cycle pol01100   Metabolic pathways pol01110   Biosynthesis of secondary metabolites pol01120   Microbial metabolism in diverse environments pol01200   Carbon metabolism pol01230   Biosynthesis of amino acids Module pol_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:pol00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     Bpro_1460    00051 Fructose and mannose metabolism     Bpro_1460   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     Bpro_1460 Enzymes [BR:pol01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      Bpro_1460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  ABE43408 UniProt:  Q12DI4 LinkDB All DBs Position 1511071..1511520 Genome browser AA seq 149 aa AA seqDB search MKLAIGCDEAAYDLKQTLKKHMIDAGHEVTDFGTHDAQPVLYPDVAFAVAEQVAGGAYER ALLLCGTGIGMAISANKVKGVRAAQCHDTYSAERASRSNDAQIITIGARVVGPELAKSIV DAWLRSGFDGGRSQPKVDLIQAYEAGHSL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaacttgccattggctgtgacgaggccgcctacgacctcaagcaaacgcttaaaaaa cacatgattgacgccggccacgaggtgaccgatttcggcacccatgacgcgcagccggtg ctctacccggatgtggccttcgcggtggcggagcaggtggcgggcggcgcctatgaacgt gccttgctgctgtgcggcaccggcatcggcatggcgatatcggccaacaaggtcaagggc gtgcgcgcggcgcagtgccacgacacctactcggccgagcgcgccagccgcagcaatgac gcgcagatcatcaccatcggcgcgcgggtggtcggccccgagctggccaaatccatcgtg gacgcctggctgcgcagcggcttcgatggcgggcgttcgcagcccaaggtcgacctgatc caggcctacgaagcggggcattcgctatga

DBGET integrated database retrieval system