Polaromonas sp. JS666: Bpro_3295 Help Entry Bpro_3295         CDS       T00343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pol  Polaromonas sp. JS666 Pathway pol01100   Metabolic pathways pol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bpro_3295    00074 Mycolic acid biosynthesis     Bpro_3295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bpro_3295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABE45209 UniProt:  Q127T3 LinkDB All DBs Position 3492447..3492767 Genome browser AA seq 106 aa AA seqDB search MSKSTSTMSESSSQPVTTPVADAALMREVAELVVSSLNLETAAADIQPDDALYGDGLGLD SIDILEIALVVSKRYGLQLRADNEDNTAIFHSLRSLSEHIALQRTK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtccaagtccacgtccacgatgtctgaatcttcttcacaaccagttaccacgcctgta gccgatgctgccctgatgcgtgaagtcgccgaactggtggtctcctcgctcaacctggaa acagcggccgccgacatccagcccgacgatgccctgtatggggacggcttgggcctcgat tcgatcgacatcctcgagatcgcgctggtggtgtccaaacgctacggcctgcagctgcgc gcagacaatgaagacaacacggccatcttccactcgctgcgcagcctgagcgaacacatc gcgctgcaaagaacgaagtga

DBGET integrated database retrieval system