Polynucleobacter sp. KF022: PKF022_04350 Help Entry PKF022_04350      CDS       T10441                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism polk  Polynucleobacter sp. KF022 Pathway polk01100   Metabolic pathways polk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:polk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PKF022_04350 (acpP)    00074 Mycolic acid biosynthesis     PKF022_04350 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PKF022_04350 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  BDT74770 LinkDB All DBs Position 415671..415910 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEGDIKNESSFVNDLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDFAKSKAQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgttaagaaaatcgtcgctgagcaattaggcgtcgcagaa ggagatatcaagaatgaatcttctttcgtgaacgacttgggcgctgactctcttgacact gttgagctggttatggctttggaagatgaattcggtatcgaaattcctgatgaggaagct gaaaaaatcactacagttcagctcgcgatcgacttcgctaaatcaaaagctcagggttaa

DBGET integrated database retrieval system