Pollutimonas sp. M17: OEG81_03930 Help Entry OEG81_03930       CDS       T09676                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism poll  Pollutimonas sp. M17 Brite KEGG Orthology (KO) [BR:poll00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:poll03036]     OEG81_03930 (ftsL) Chromosome and associated proteins [BR:poll03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OEG81_03930 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF5471 Doppel Motif Other DBs NCBI-ProteinID:  UYO94488 LinkDB All DBs Position 809561..809863 Genome browser AA seq 100 aa AA seqDB search MGRLSLLFACLLMISALSLVTARFQSRQLFVQADRLEDKARELDTDWRRLQLERAELARN ARIDATARKELEMVSATPDRTLYIKGQAPAAPVPGEGGRP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgggtcgactgagcctgctgtttgcctgcctgctgatgatttcagccctgtcgctggtc acggcccgattccagtcccgtcaactgttcgtgcaggccgacaggctcgaggacaaggcg cgcgagctcgacaccgactggcgccggctgcagctggagcgcgccgagctggcgcgcaat gcgcggatcgacgccacggcgcgcaaagaactggaaatggtgtccgccacccccgacagg accttgtacatcaaaggccaggcgcccgccgccccagttccaggcgaagggggccggcca tga

DBGET integrated database retrieval system