| Entry |
|
|---|
| Symbol |
COX8A
|
|---|
| Name |
(RefSeq) cytochrome c oxidase subunit 8A, mitochondrial
|
|---|
| KO |
| K02273 | cytochrome c oxidase subunit 8 |
|
|---|
| Organism |
pon Pongo abelii (Sumatran orangutan)
|
|---|
| Pathway |
| pon04932 | Non-alcoholic fatty liver disease |
| pon05022 | Pathways of neurodegeneration - multiple diseases |
| pon05208 | Chemical carcinogenesis - reactive oxygen species |
|
|---|
| Module |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:pon00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
100172325 (COX8A)
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
100172325 (COX8A)
09159 Environmental adaptation
04714 Thermogenesis
100172325 (COX8A)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
100172325 (COX8A)
09164 Neurodegenerative disease
05010 Alzheimer disease
100172325 (COX8A)
05012 Parkinson disease
100172325 (COX8A)
05014 Amyotrophic lateral sclerosis
100172325 (COX8A)
05016 Huntington disease
100172325 (COX8A)
05020 Prion disease
100172325 (COX8A)
05022 Pathways of neurodegeneration - multiple diseases
100172325 (COX8A)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
100172325 (COX8A)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
100172325 (COX8A)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
9:complement(10727306..10729201)
|
|---|
| AA seq |
69 aa
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEEKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE |
|---|
| NT seq |
210 nt +upstreamnt +downstreamnt
atgtccgtcctgacgccgctgctgctgcggggcttgacaggctcggcccggcggctccca
gtgccgcgcgccaagatccattcgttgccgccggaggagaagcttgggatcatggaattg
gccgttgggcttacctcctgcttcgtgaccttcctcctgccagcgggctggatcctgtca
cacctggagacctacaggaggccggagtga |
|---|
