Pongo abelii (Sumatran orangutan): 100173171 Help Entry 100173171         CDS       T01416                                  Symbol MYL6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04270   Vascular smooth muscle contraction pon04530   Tight junction pon04814   Motor proteins pon04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:pon00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100173171 (MYL6)   09142 Cell motility    04814 Motor proteins     100173171 (MYL6)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     100173171 (MYL6)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100173171 (MYL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100173171 (MYL6)    04147 Exosome [BR:pon04147]     100173171 (MYL6) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      100173171 (MYL6) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100173171 (MYL6)   Exosomal proteins of bladder cancer cells    100173171 (MYL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF_EFCAB10_C AIF-1 EF-hand_9 EF-hand_5 Motif Other DBs NCBI-GeneID:  100173171 NCBI-ProteinID:  NP_001126203 Ensembl:  ENSPPYG00000004647 UniProt:  Q5R844 A0A2J8UHY3 LinkDB All DBs Position 10:54060999..54064543 Genome browser AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEAFVRHILSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac tatgaagcgtttgtgaggcatatcctgtcggggtga

DBGET integrated database retrieval system